Protein Info for Psyr_3392 in Pseudomonas syringae pv. syringae B728a

Annotation: Cytochrome c-type biogenesis protein CcmB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 92 to 119 (28 residues), see Phobius details amino acids 130 to 154 (25 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 194 to 217 (24 residues), see Phobius details PF03379: CcmB" amino acids 7 to 219 (213 residues), 234.9 bits, see alignment E=3.6e-74 TIGR01190: heme exporter protein CcmB" amino acids 8 to 218 (211 residues), 279.3 bits, see alignment E=9.7e-88

Best Hits

Swiss-Prot: 86% identical to CCMB_PSEAE: Heme exporter protein B (ccmB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02194, heme exporter protein B (inferred from 100% identity to psb:Psyr_3392)

MetaCyc: 55% identical to cytochrome c maturation protein B (Escherichia coli K-12 substr. MG1655)
RXN-21408

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, CcmB subunit" in subsystem Biogenesis of c-type cytochromes

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQZ8 at UniProt or InterPro

Protein Sequence (223 amino acids)

>Psyr_3392 Cytochrome c-type biogenesis protein CcmB (Pseudomonas syringae pv. syringae B728a)
MSNVFVLLMLREVRLLARRPAELTNPLVFFAIVVALFPLALGPQTQLLQTLSPGLVWVAA
LLAVLLSLDGLLRSDFEDGSLEQWVLSPHPLALLVLIKVLAHWVFSGLALVLLSPLLALM
LGLPVQCLPVLMVSLLLGTPVLSLLGALGAALTVGLKRGGLLLALLILPLYIPVLILGSG
ALQAALQGMPATGYLLWLASLAALAITLTPFAIAAGLKISIGE