Protein Info for Psyr_3391 in Pseudomonas syringae pv. syringae B728a

Annotation: Cytochrome c-type biogenesis protein CcmC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 31 to 54 (24 residues), see Phobius details amino acids 67 to 94 (28 residues), see Phobius details amino acids 101 to 125 (25 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 23 to 194 (172 residues), 117 bits, see alignment E=4.9e-38 TIGR01191: heme exporter protein CcmC" amino acids 55 to 238 (184 residues), 271.7 bits, see alignment E=1.6e-85

Best Hits

Swiss-Prot: 79% identical to CCMC_PSEAE: Heme exporter protein C (ccmC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02195, heme exporter protein C (inferred from 100% identity to psb:Psyr_3391)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmC, putative heme lyase for CcmE" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQZ9 at UniProt or InterPro

Protein Sequence (267 amino acids)

>Psyr_3391 Cytochrome c-type biogenesis protein CcmC (Pseudomonas syringae pv. syringae B728a)
MKSNAMKSSIGWAWLHTLGSPKGFYRVSARLLPWMSVVAVLLLVIGMVWGLAFAPPDYQQ
GNSFRIIYIHVPAAMLAQSCYVMLAVCGLVGLVWRIKLADVALHCAAPIGAWMTALALAT
GAIWGKPTWGAWWVWDARLTSMLILLFLYFGLIALGNAISNRDSAAKACAVLAIVGVVNI
PIIKYSVEWWNTLHQGSTFSLTEKPAMPAEMWLPLLFTTLGFYCLFGVLLMMRMRLEVLR
REARTQWVKAEILRSLGHTAAQSENTL