Protein Info for Psyr_3385 in Pseudomonas syringae pv. syringae B728a

Annotation: TPR repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 94 to 113 (20 residues), see Phobius details TIGR03142: cytochrome c-type biogenesis protein CcmI" amino acids 4 to 116 (113 residues), 101.1 bits, see alignment E=2.5e-33 PF23914: TPR_CcmH_CycH" amino acids 132 to 256 (125 residues), 69 bits, see alignment E=1.1e-22 PF23892: Ig_CycH" amino acids 288 to 393 (106 residues), 124.9 bits, see alignment E=2.9e-40

Best Hits

Swiss-Prot: 62% identical to CYCH_PSEAE: Cytochrome c-type biogenesis protein CycH (cycH) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02200, cytochrome c-type biogenesis protein CcmH (inferred from 100% identity to psb:Psyr_3385)

Predicted SEED Role

"Cytochrome c heme lyase subunit CcmH" in subsystem Biogenesis of c-type cytochromes or Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZR05 at UniProt or InterPro

Protein Sequence (397 amino acids)

>Psyr_3385 TPR repeat protein (Pseudomonas syringae pv. syringae B728a)
MIDFWMAAGLLLLVALSFLLIPLLRGHRAQREEDRTALNVALYQERLNELQVQQEQGVLS
VAQLQAARTEAARELLADTEGAEPDRTSRLGKPLLVLAALLVPMLGLAGYLQLGASDRVE
LSREFARPPTSLADMTQRLERSVQAQPDSAENLYFLARSYMAQNRPGDAAQMFERSVALA
GRQPELLGQWAQALYFASDKHFTPQVQALTDEALQADPREVTSLGLLGIAAFETQRYQAA
VDYWTRLLAALPADDASRSALEGGIARARDNLAKRAADAAPAVKAKSIKIHVELAAALQG
KVRPNDSVFIFARAINGPAAPLAVKRITVADLPAEVELSDADAMMPQLNLSNFAQVQLVA
RVSRAGQPTTGEWVGRSQPLASDTAAQQALTIDSPDN