Protein Info for Psyr_3375 in Pseudomonas syringae pv. syringae B728a

Annotation: Heavy metal sensor kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details TIGR01386: heavy metal sensor kinase" amino acids 6 to 460 (455 residues), 482.9 bits, see alignment E=5.8e-149 PF00672: HAMP" amino acids 186 to 237 (52 residues), 42.6 bits, see alignment 1.2e-14 PF26769: HAMP_PhoQ" amino acids 191 to 237 (47 residues), 34 bits, see alignment 4.7e-12 PF00512: HisKA" amino acids 244 to 307 (64 residues), 53 bits, see alignment E=5.7e-18 PF02518: HATPase_c" amino acids 352 to 460 (109 residues), 75.8 bits, see alignment E=7.2e-25

Best Hits

KEGG orthology group: K07644, two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC: 2.7.13.3] (inferred from 100% identity to psb:Psyr_3375)

Predicted SEED Role

"Heavy metal sensor histidine kinase" in subsystem Cobalt-zinc-cadmium resistance

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZR15 at UniProt or InterPro

Protein Sequence (462 amino acids)

>Psyr_3375 Heavy metal sensor kinase (Pseudomonas syringae pv. syringae B728a)
MRRQPSLTLRSTLAFALVAMLTVSGAGLYLYQSIEETVMQRSDHAVLARLDHFRKLLRYD
LTMGNLKGSPQLFENMLDSEEDIFIIGEPGKSPVISVNPQHAPLPELPTVAQDQPLRVDD
LRSGMSLQGVPLRAAAVQVMSNGVEVRLQAAHLMVKEMAMLASFRQRIYIAVALAFLITA
ALGYVLLRRGLRPLRRMAAHAAAITPASLHKRLDSRDTPVELQQLSDAFNAMLDRLDDGY
RRLMQFSADLAHEIRTPVGSLMGHCQVALRQNRSADEYQALLASNLEELERISRLVESIL
FLARADEAQAALERQALDMHDELQRVAGYFEGLAEERNLTLSTHGQGTLLADPILLRRAL
SNLVANAIRYADEDSEILMRVTAVDRHWKIDVENQGPVLPEATLARLFDRFYRGDASRHE
RSDSNGLGLAIVTAIMQLHGGRVEVAQPAVGRICFSLIFPAA