Protein Info for Psyr_3372 in Pseudomonas syringae pv. syringae B728a

Annotation: conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 56 to 79 (24 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 161 to 184 (24 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 7 to 194 (188 residues), 88.5 bits, see alignment E=2.5e-29

Best Hits

Swiss-Prot: 50% identical to YEDZ1_AZOOP: Putative protein-methionine-sulfoxide reductase subunit YedZ1 (yedZ1) from Azospira oryzae (strain ATCC BAA-33 / DSM 13638 / PS)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3372)

Predicted SEED Role

"Thiosulfate reductase cytochrome B subunit (membrane anchoring protein)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZR18 at UniProt or InterPro

Protein Sequence (206 amino acids)

>Psyr_3372 conserved hypothetical protein (Pseudomonas syringae pv. syringae B728a)
MKTRPIHPWPVRLTHWVNAVGMVCMFMSGWAIYNASPLMPFTFPKFLTLGGWLGGSIAWH
FAVMWLLVINGLIYVLYGVFSRHFKRDLLPVRPSEVTRDMNDALHFRLVHVKGRYNAVQR
LMYWLVLAMGVLVVLSGLAIWKPVQFQGLVSLLGGFDFARWVHFGAMTAIGAFVIVHLLL
VVLVPSTLLPMITGGRQPNEDGTAQS