Protein Info for Psyr_3370 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function DUF451

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF09375: Peptidase_M75" amino acids 46 to 277 (232 residues), 139.2 bits, see alignment E=1.1e-44

Best Hits

Swiss-Prot: 43% identical to EFEMO_STAAW: Efem/EfeO family lipoprotein (MW0319) from Staphylococcus aureus (strain MW2)

KEGG orthology group: K07224, putative lipoprotein (inferred from 100% identity to psb:Psyr_3370)

Predicted SEED Role

"Ferrous iron transport periplasmic protein EfeO, contains peptidase-M75 domain and (frequently) cupredoxin-like domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZR20 at UniProt or InterPro

Protein Sequence (285 amino acids)

>Psyr_3370 Protein of unknown function DUF451 (Pseudomonas syringae pv. syringae B728a)
MTYPLLTRKTLMKKTPLALLLTLGLLQTPLAAFAATAPLDLVGPVSDYKIYVTENIEELV
SHTQKFTDAVKKGDIATAKKLYAPTRVYYESVEPIAELFSDLDASIDSRVDDHEQGVAAE
DFTGFHRLEYALFSQNTTKDQGPIADKLLSDVKDLEKRVADLTFPPEKVVGGAAALLEEV
AATKISGEEDRYSHTDLYDFQGNIDGAKKIVDLFRPQIEQQDKAFSSKVDKNFATVDKIL
AKYKTKDGGFETYDKVKENDRKALVGPVNTLAEDLSTLRGKLGLN