Protein Info for Psyr_3360 in Pseudomonas syringae pv. syringae B728a

Annotation: Major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 transmembrane" amino acids 22 to 40 (19 residues), see Phobius details amino acids 52 to 75 (24 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 106 to 131 (26 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 207 to 226 (20 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 275 to 295 (21 residues), see Phobius details amino acids 301 to 321 (21 residues), see Phobius details amino acids 332 to 356 (25 residues), see Phobius details amino acids 362 to 379 (18 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 316 (295 residues), 75.7 bits, see alignment E=1.7e-25

Best Hits

Swiss-Prot: 56% identical to Y1221_YERPE: Uncharacterized MFS-type transporter YPO1221/y2967/YP_0917 (YPO1221) from Yersinia pestis

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3360)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZR30 at UniProt or InterPro

Protein Sequence (383 amino acids)

>Psyr_3360 Major facilitator superfamily (Pseudomonas syringae pv. syringae B728a)
MTSFSTAAQDAKARAEQSSTRIAFFIAGFSVASWAPLVPYVKQRMGLDEGTLGLLLLCLG
VGSIISMPLAGALAARFGCRRLLVCSTLLICLCLPLLATISSLPLLIATLFLFGASMGGV
DCTANVQAVIVERASGKTMMSGFHGLFSLGGIVGAAGVAGLLSLGISPFAAMLIVVVLTL
AALAKAAPNLLPYGSPSDGPAFAIPRGVVLFIGLLCFTVFLAEGAMLDWSAVFLTSLRGV
EPSYAGLGYAVFAATMTLGRLFGDAVVKRVGSTRVIILGGLCAAAGLAVATLIPFWQAAL
LGYALVGAGCSNIVPVCYSAAGRQKTMPESVAIPAITTVGYAGILIGPAAIGFIAHVSSL
ELAFMIVAVMLVGVAIGGSKLRT