Protein Info for Psyr_3354 in Pseudomonas syringae pv. syringae B728a

Annotation: Ankyrin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF13637: Ank_4" amino acids 41 to 93 (53 residues), 31.3 bits, see alignment E=5.1e-11 amino acids 80 to 125 (46 residues), 28.5 bits, see alignment E=3.9e-10 PF12796: Ank_2" amino acids 46 to 133 (88 residues), 51.9 bits, see alignment E=2.3e-17 amino acids 96 to 169 (74 residues), 44 bits, see alignment E=7e-15 PF13857: Ank_5" amino acids 65 to 110 (46 residues), 33.4 bits, see alignment E=1.1e-11 PF00023: Ank" amino acids 73 to 104 (32 residues), 24.8 bits, see alignment 4.8e-09 amino acids 106 to 134 (29 residues), 15.2 bits, see alignment 5.5e-06 amino acids 139 to 169 (31 residues), 17.2 bits, see alignment 1.3e-06

Best Hits

KEGG orthology group: K06867, (no description) (inferred from 100% identity to psb:Psyr_3354)

Predicted SEED Role

"FOG: Ankyrin repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZR36 at UniProt or InterPro

Protein Sequence (189 amino acids)

>Psyr_3354 Ankyrin (Pseudomonas syringae pv. syringae B728a)
MKHLIYGLLLFAAAANATPPTPTPTPAPSELSAEQTASQLRTLFFDASREGNNPMLDTFI
EAHYDLNIRDEQGYTGLILAAYHGHEDSVIRLIDAGADPCAKDNRGNTALMGAIFKGELS
IAKRLVQADCGANLTNNAGQTAAMYAALFKRTEVLKELTDKGADLSIRDSMGNDVEGLSK
GEFQAPPTR