Protein Info for Psyr_3329 in Pseudomonas syringae pv. syringae B728a

Annotation: diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensor(s)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 732 PF01590: GAF" amino acids 28 to 154 (127 residues), 53.8 bits, see alignment E=1.1e-17 TIGR00229: PAS domain S-box protein" amino acids 170 to 294 (125 residues), 78.8 bits, see alignment E=3.8e-26 PF00989: PAS" amino acids 177 to 286 (110 residues), 47.3 bits, see alignment E=6.9e-16 PF08448: PAS_4" amino acids 181 to 290 (110 residues), 42.4 bits, see alignment E=2.6e-14 PF13426: PAS_9" amino acids 183 to 288 (106 residues), 39 bits, see alignment E=3e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 296 to 455 (160 residues), 121.3 bits, see alignment E=3.3e-39 PF00990: GGDEF" amino acids 300 to 451 (152 residues), 122.2 bits, see alignment E=6.5e-39 PF00563: EAL" amino acids 474 to 708 (235 residues), 232 bits, see alignment E=2.4e-72

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3329)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZR61 at UniProt or InterPro

Protein Sequence (732 amino acids)

>Psyr_3329 diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensor(s) (Pseudomonas syringae pv. syringae B728a)
MNTYPVGDDDEERIRILNAFSLMDTPPEHEYDQIVQMASRIFDLPIVLISLVHRDRQFFK
ARVGLDVCETGRDVSFCNFALMGRNVFLVPDALQDERFSSNALVVGAPHIRFYAGAPLIT
ASGHVLGSLCLIDNKPRETFSERDQLVLQDLAVMIIERMELRRLTLENEDSHTRFMNITS
TSPDAIICSDSKNRIISWNNSAEIIFGHRSEDAMGKPLDIIIPPEMRSRHHAGLSRVAAG
GPASIIGKSINLTAVHRDGHTIPIELSLSQWTSAGEPQFGAIIRDITQRVEADKLLKHAA
EYDHLTGLANRSTLKRRIKEACDAQLSAAILLIDLDGFKDVNDTLGHAAGDFVLKVTSHR
LREHVPACHMVSRLGGDEFVVFLSETADPDKAIKLGLELIAVIEEPIEFEDNSIYIGASI
GVSVRCGSDYDEEQMLGNADLALYQAKSDGRSLVRTFTSEHRQTASRRGALSSSMRQAWA
NKEFELYYQPQVRLADGRITGAEALIRWNHPTLGVVSPAVFLPALEASLLAVPVGEWILR
SACEQAAQWRNTGCEEFRIGVNLFAAQFRMRDFAEMVESALEDFSLPAHSLELEITENII
LRNEQRIMEPLRHLRSLGVGIAFDDFGTGYASLSLLKDYPVTRLKIDRSFVSGVERSKKD
EVIVEAVVRLANGFNLQVTAEGIETREQESLMRHYVCDEGQGYLYGRPMPAHEFTKRYIS
SHNWHADVLKHN