Protein Info for Psyr_3322 in Pseudomonas syringae pv. syringae B728a

Annotation: Major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 45 to 68 (24 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 210 to 232 (23 residues), see Phobius details amino acids 244 to 266 (23 residues), see Phobius details amino acids 275 to 294 (20 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details amino acids 333 to 354 (22 residues), see Phobius details amino acids 364 to 384 (21 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 350 (324 residues), 92.7 bits, see alignment E=1.1e-30

Best Hits

Swiss-Prot: 39% identical to CYNX_ECOLI: Cyanate transport protein CynX (cynX) from Escherichia coli (strain K12)

KEGG orthology group: K03449, MFS transporter, CP family, cyanate transporter (inferred from 100% identity to psb:Psyr_3322)

Predicted SEED Role

"Cyanate transport protein CynX" in subsystem Cyanate hydrolysis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZR68 at UniProt or InterPro

Protein Sequence (408 amino acids)

>Psyr_3322 Major facilitator superfamily (Pseudomonas syringae pv. syringae B728a)
MQMRGSAVQNMGLMISVLLVALNLRPSMAAVGPLLVAIRLDVPLGFGTASLLTMLPVMAM
GLAMFFGMGIARYLGSYRSIMLSLALIGLATLARLFLDSAAELIFSAVLAGLGIALIQAL
MPALIKSRFKADVSLYMGLYVTAIMGGAALAASFSPLLMSSSGSWRVGLAVCSLLALLAM
CFWFAQRHVLQSDASIAAGHRQTFFHMPRAWMLGIFFGLGTASYTCVLAWLAPYYLENGW
GEQGAGLLLGFLTLMEVVSGLLVPALANRSRDKRVALVVLLILMMTGFAGLILMPQQLGL
LWACLLGLGIGGLFPMSLIVSMDHCDDPQQAGSLTAFVQGVGYLIASLSPLLAGVIRDLT
GSFAGAWWSLMALVVIMLLMVVRLDPRRYADHLRDALGEPVITGRQAE