Protein Info for Psyr_3307 in Pseudomonas syringae pv. syringae B728a

Annotation: Glycosyl transferase, group 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 70 to 90 (21 residues), see Phobius details PF13579: Glyco_trans_4_4" amino acids 17 to 205 (189 residues), 45.5 bits, see alignment E=2.6e-15 PF13439: Glyco_transf_4" amino acids 17 to 210 (194 residues), 48.9 bits, see alignment E=2e-16 PF13692: Glyco_trans_1_4" amino acids 222 to 355 (134 residues), 86.1 bits, see alignment E=7.2e-28 PF13524: Glyco_trans_1_2" amino acids 250 to 387 (138 residues), 54.6 bits, see alignment E=3e-18 PF00534: Glycos_transf_1" amino acids 275 to 371 (97 residues), 38 bits, see alignment E=3.2e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3307)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZR83 at UniProt or InterPro

Protein Sequence (405 amino acids)

>Psyr_3307 Glycosyl transferase, group 1 (Pseudomonas syringae pv. syringae B728a)
MRILWTLPYLPWPTTSGGKTREYHLLRNLAGRGHRITLLVQSKNPLDDDARAALEPWLER
LIVIERRPLLSLRTLLAVAFAAPPMLASVNGYAPQLEKAFEQLLKEDWDIIQLQHTYAFQ
PFERALKRSGKPFVLTEHNVESDLGAASYDRLPRWANAFAVYDRWRYRRWETRVFRQTGE
LIAVTEDDAKVLSRLSGRATSYVVNSVDCDYYASVHADRHSHRLLFIGNYEYGPNVDAIE
WALDEIMPQVWAQAPHVRFAIGGFGMPQTWRERWPDPRIEWLGFVPDLRALQATASMFFA
PLRQGGGSKLKTLEAMAAGLPVVTTAQGVSGLTVRHGEHYLGSEDAAGLAALIAEYTDKP
LQLEQIGEAGRVYVRARHDWSVSAAQLEVIYTRFSFSKQGLRSCV