Protein Info for Psyr_3299 in Pseudomonas syringae pv. syringae B728a

Annotation: two component transcriptional regulator, LuxR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 PF00072: Response_reg" amino acids 6 to 116 (111 residues), 89 bits, see alignment E=3.6e-29 PF00196: GerE" amino acids 156 to 204 (49 residues), 54.1 bits, see alignment 1.5e-18

Best Hits

Swiss-Prot: 33% identical to NARL_ECOLI: Nitrate/nitrite response regulator protein NarL (narL) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3299)

MetaCyc: 33% identical to DNA-binding transcriptional dual regulator NarL (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA-binding response regulator, LuxR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZR91 at UniProt or InterPro

Protein Sequence (220 amino acids)

>Psyr_3299 two component transcriptional regulator, LuxR family (Pseudomonas syringae pv. syringae B728a)
MTCNLLLVDDHSLIRAGVRALVADMPGYTILGETADGAQLAGLAQQLKPDIILFDICMKS
VDGLDALEQLLKVQPHCKVLILSMQNDPDMIMRALDIGAQGYLLKDTTAAELEQALGALR
GNERYLSPGIAHTVIERALRGKRSDRARSAKERYHLTARQLEILRLIVRGKSTREIADGL
GLSVKTIETHRAQVMKRLQIFDVAGLVLFCVRERIISLDD