Protein Info for Psyr_3283 in Pseudomonas syringae pv. syringae B728a

Annotation: SOS-response transcriptional repressor, LexA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 TIGR00498: repressor LexA" amino acids 1 to 202 (202 residues), 254.8 bits, see alignment E=2.8e-80 PF01726: LexA_DNA_bind" amino acids 1 to 65 (65 residues), 103.5 bits, see alignment E=4e-34 PF00717: Peptidase_S24" amino acids 81 to 194 (114 residues), 118.6 bits, see alignment E=1.2e-38

Best Hits

Swiss-Prot: 99% identical to LEXA1_PSESM: LexA repressor 1 (lexA1) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K01356, repressor LexA [EC: 3.4.21.88] (inferred from 99% identity to psp:PSPPH_3203)

Predicted SEED Role

"SOS-response repressor and protease LexA (EC 3.4.21.88)" in subsystem DNA repair, bacterial (EC 3.4.21.88)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.88

Use Curated BLAST to search for 3.4.21.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRA7 at UniProt or InterPro

Protein Sequence (202 amino acids)

>Psyr_3283 SOS-response transcriptional repressor, LexA (Pseudomonas syringae pv. syringae B728a)
MIKLTPRQAEILGFIKRCLEDNGFPPTRAEIAQELGFKSPNAAEEHLKALARKGAIEMTP
GASRGIRIPGFEARQDDSSLPVIGRVAAGAPILAQQHIEESCNINPSFFHPSANYLLRVH
GMSMKDVGILDGDLLAVHTTREARNGQIVVARIGDEVTVKRFKREGSKVWLLAENPDFAP
IEVDLKDQELVIEGLSVGVIRR