Protein Info for Psyr_3272 in Pseudomonas syringae pv. syringae B728a

Annotation: 5-deoxyglucuronate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF04962: KduI" amino acids 6 to 266 (261 residues), 336.1 bits, see alignment E=7.1e-105 TIGR04378: 5-deoxy-glucuronate isomerase" amino acids 21 to 266 (246 residues), 299.3 bits, see alignment E=1.1e-93

Best Hits

KEGG orthology group: K03337, 5-deoxy-glucuronate isomerase [EC: 5.3.1.-] (inferred from 100% identity to psb:Psyr_3272)

Predicted SEED Role

"5-deoxy-glucuronate isomerase (EC 5.3.1.-)" in subsystem Inositol catabolism (EC 5.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.-

Use Curated BLAST to search for 5.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRB8 at UniProt or InterPro

Protein Sequence (269 amino acids)

>Psyr_3272 5-deoxyglucuronate isomerase (Pseudomonas syringae pv. syringae B728a)
MNLLTKSKSTGRDVVALAPGSLEYVNFAAYRLESGESLPLSAGENELCVVLLTGHASVSG
EAPGQGAFNWENIGDRQSVFEEKSPFAVYLPPHSQAQFVARGAVQLAVCTAPGDAGKHFP
ARLIMPGSMKRSVRGKGANTRYVCDILPDSEAAHSLLVVEVRTPSGHSSSYPPHKHDRDN
LPHESFLEETYYHQVNPPQGFVFQRVYTDDRSIDQAMAVENNDLVTVPKGYHPVSVPYGY
ESWYLNVMAGPTRAWQFHNDPQHSWLLDL