Protein Info for Psyr_3264 in Pseudomonas syringae pv. syringae B728a

Annotation: monosaccharide ABC transporter ATP-binding protein, CUT2 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 PF00005: ABC_tran" amino acids 48 to 198 (151 residues), 117.6 bits, see alignment E=7e-38 amino acids 298 to 451 (154 residues), 86.4 bits, see alignment E=3e-28

Best Hits

Swiss-Prot: 100% identical to RGMG_PSEU2: Putative ribose/galactose/methyl galactoside import ATP-binding protein (Psyr_3264) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K02056, simple sugar transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 100% identity to psb:Psyr_3264)

MetaCyc: 49% identical to D-galactose/methyl-galactoside ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-18-RXN; TRANS-RXN0-541

Predicted SEED Role

"Inositol transport system ATP-binding protein" in subsystem Inositol catabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRC6 at UniProt or InterPro

Protein Sequence (525 amino acids)

>Psyr_3264 monosaccharide ABC transporter ATP-binding protein, CUT2 family (Pseudomonas syringae pv. syringae B728a)
MFGSATANPPAQRNLPSGDGDGGAPDAQAPYLLEISHVSKGFPGVVALNDVQLRVRPGSV
LALMGENGAGKSTLMKIIAGIYQPDAGEIRLRGKPVSFDTPLSALQAGIAMIHQELNLMP
FMSIAENIWIGREQLNGLHMVDHREMHRCTAELLERLRIKLDPEELVGTLSIAERQMVEI
AKAVSYNSDVLIMDEPTSAITETEVAHLFSIISDLRAQGKGIIYITHKMNEVFEIADEVA
VFRDGAYIGLQRADSMDGDSLITMMVGRELTQLFPEREKPAGDVLLSVNRLSLNGIFKDV
SFDLRAGEVLGIAGLMGSGRTNVAETLFGITPSDSGEVRFDGKTVHIGDPHQAIELGFAL
LTEDRKLTGLFPCLSVMENMEMAVLANYAGNGFVQQKALRSQCEDMCKKLRVKTPSLEQC
IDTLSGGNQQKALLARWLMTNPKVLILDEPTRGIDVGAKVEIYRLISLLASEGMAVIMIS
SELPEVLGMSDRVMVMHEGEMMGILDRSEATQEKVMHLASGHKVH