Protein Info for Psyr_3257 in Pseudomonas syringae pv. syringae B728a

Annotation: multisubunit potassium/proton antiporter, PhaG subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details PF03334: PhaG_MnhG_YufB" amino acids 19 to 99 (81 residues), 73.5 bits, see alignment E=6.6e-25 TIGR01300: monovalent cation/proton antiporter, MnhG/PhaG subunit" amino acids 19 to 104 (86 residues), 69.7 bits, see alignment E=1.1e-23

Best Hits

KEGG orthology group: K05564, multicomponent K+:H+ antiporter subunit G (inferred from 100% identity to psb:Psyr_3257)

Predicted SEED Role

"Na(+) H(+) antiporter subunit G" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRD3 at UniProt or InterPro

Protein Sequence (126 amino acids)

>Psyr_3257 multisubunit potassium/proton antiporter, PhaG subunit (Pseudomonas syringae pv. syringae B728a)
MTGLPNTVPFWVEILTAGLLIASSLFALTGALGLLRLKDFFQRMHPPALASTLGAWCVAL
ASIIYFSALKSEPVIHAWLIPVLLAITVPVTTLLLARTALFRKRMAGDDVPAEVSSGNGN
GESAGG