Protein Info for Psyr_3252 in Pseudomonas syringae pv. syringae B728a

Annotation: multisubunit potassium/proton antiporter, PhaA subunit / multisubunit potassium/proton antiporter, PhaB subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 972 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 107 to 126 (20 residues), see Phobius details amino acids 132 to 150 (19 residues), see Phobius details amino acids 161 to 184 (24 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details amino acids 226 to 226 (1 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details amino acids 270 to 291 (22 residues), see Phobius details amino acids 298 to 316 (19 residues), see Phobius details amino acids 321 to 343 (23 residues), see Phobius details amino acids 364 to 385 (22 residues), see Phobius details amino acids 405 to 426 (22 residues), see Phobius details amino acids 459 to 482 (24 residues), see Phobius details amino acids 502 to 523 (22 residues), see Phobius details amino acids 574 to 592 (19 residues), see Phobius details amino acids 604 to 624 (21 residues), see Phobius details amino acids 631 to 651 (21 residues), see Phobius details amino acids 657 to 678 (22 residues), see Phobius details amino acids 699 to 720 (22 residues), see Phobius details amino acids 758 to 776 (19 residues), see Phobius details amino acids 815 to 839 (25 residues), see Phobius details amino acids 848 to 868 (21 residues), see Phobius details amino acids 884 to 906 (23 residues), see Phobius details amino acids 925 to 948 (24 residues), see Phobius details PF00662: Proton_antipo_N" amino acids 65 to 110 (46 residues), 35.9 bits, see alignment 1.4e-12 PF00361: Proton_antipo_M" amino acids 126 to 404 (279 residues), 208.7 bits, see alignment E=2.8e-65 PF13244: MbhD" amino acids 615 to 680 (66 residues), 72 bits, see alignment 9.1e-24 PF20501: MbhE" amino acids 697 to 793 (97 residues), 150.7 bits, see alignment E=2.5e-48 PF04039: MnhB" amino acids 821 to 942 (122 residues), 124.7 bits, see alignment E=6.8e-40

Best Hits

KEGG orthology group: K05559, multicomponent K+:H+ antiporter subunit A (inferred from 68% identity to ajs:Ajs_2474)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRD8 at UniProt or InterPro

Protein Sequence (972 amino acids)

>Psyr_3252 multisubunit potassium/proton antiporter, PhaA subunit / multisubunit potassium/proton antiporter, PhaB subunit (Pseudomonas syringae pv. syringae B728a)
MSLIVLLLLPFIGSCLAAFLPHNARNAESFLAGLIALIGAVQMALWFPQIADGGVIREEY
FWLPSLGMNFVLRIDGFAWLFSMLVLGIGALVSLYARYYMSPDDPVPRFFAFFLAFMGAM
LGLVMSGNLIQIVFFWELTSLFSFLLIGYWHHRADARRGAYMALMVTGAGGLALLAGMMI
LGHVAGSYDLDRVLASGDAIRAHALYPVLLTLILIGALTKSAQFPFHFWLPHAMAAPTPV
SAYLHSATMVKAGVFLMARMWPALSGTEQWFWIVSGAGACTLILGAYAAIFQNDLKGLLA
YSTISHLGLITLLLGLNSPLAAVAAVFHILNHATFKASLFMAAGIIDHESGTRDIRRLSG
LIRLLPYTATLAMVASASMAGVPLLNGFLSKEMFFAETVFISATAWVEIALPVIATIAGI
FSVAYSLRFTVDVFFGPAAKDLPHLPHEPPRWMRAPVELLVLTCLVVGIFPAQSVAPLLA
AAARPVVGGTLPEYSLAIWHGWNLPMVMSLVAMAGGIILYLLLRKPLKHERITAPPLVGR
LNGKRFFERSQVVMMHWARRFERKVSTRRLQPQLFLLVLAAVLGGFIPMYFSGLTWGDRP
KIPGSGVFVTLWLIAIACAIGAAWQGKYHRLAALVMVSVCGLMTCITFVWFSAPDLALTQ
LVVEVVTTVLILLGLRWLPRRNEDVAPLSARLRARTRRIRDFGLAVLVGLGMAILSYAML
TRQTPNAISSFYLSRALPQGGGTNVVNVMLVDFRGFDTFGEITVLAAVAMTVFALLRRFR
PPKESILLPAQQRLLARDVVTDLVNPRSASDTALGFMMVPAALVRLLLPIAFIISMYLFV
RGHNQPGGGFVAGLVMSVAFILQYMVAGTQWVEAQMSLRPLRWMGTGLLCAVLTGAGSML
LGYPFMTTHTAHVDLPILGDIHIASALFFDVGVYAVVVGSTLLILTALAHQSVRSHRPTQ
LPKPVANPQGIL