Protein Info for Psyr_3231 in Pseudomonas syringae pv. syringae B728a

Annotation: sugar transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 46 to 63 (18 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 158 to 176 (19 residues), see Phobius details amino acids 284 to 309 (26 residues), see Phobius details amino acids 448 to 460 (13 residues), see Phobius details TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 23 to 468 (446 residues), 488.5 bits, see alignment E=2.5e-150 TIGR03023: undecaprenyl-phosphate glucose phosphotransferase" amino acids 28 to 469 (442 residues), 567.1 bits, see alignment E=3.9e-174 PF13727: CoA_binding_3" amino acids 66 to 243 (178 residues), 106.9 bits, see alignment E=1.3e-34 PF02397: Bac_transf" amino acids 279 to 461 (183 residues), 231.6 bits, see alignment E=4.9e-73

Best Hits

KEGG orthology group: K03606, putative colanic acid biosysnthesis UDP-glucose lipid carrier transferase (inferred from 100% identity to psb:Psyr_3231)

Predicted SEED Role

"Undecaprenyl-phosphate galactosephosphotransferase (EC 2.7.8.6)" (EC 2.7.8.6)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRF9 at UniProt or InterPro

Protein Sequence (469 amino acids)

>Psyr_3231 sugar transferase (Pseudomonas syringae pv. syringae B728a)
MRTSVRGILRAHQSALSLAHRLLDLAVIVLIGYWQTGLTVTDSTEAWSHIFLAVLVFHWV
SEYHQLYGSWRGERILRELTKVFSYWAMTFITLLSLNSLLLNQTQLPDNGQMSWFALALA
VLCGYRLLIRLALHTLRRRGFNTRRVAIVGTGQVGERLARSIALAPWMGLILLGFYDSHP
QQMNLQAHKRRPRVLGDLQQLIDDARAGRIDKVYITLAFSAEPQLRELITGLSDTTASVY
LIPDVFMFDLLHARSESINGLASISIFDSPMDGAWSLAKRAEDIVLSSLILLLIAVPLLI
IAAAIKLTSAGPVLFRQRRYGLDGRSIMVWKFRSMSVQANTDVVLQATRNDTRVTPLGRF
LRRTSLDELPQFFNVLLGDMSIVGPRPHAIAHNEQYRRQVSGYMLRHKVKPGITGWAQIN
GWRGETDTLDKMRMRVEFDLEYIEHWSIWLDLKIILLTLLKGFVNKNAF