Protein Info for Psyr_3230 in Pseudomonas syringae pv. syringae B728a

Annotation: Glycosyl transferase, group 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 PF13439: Glyco_transf_4" amino acids 15 to 190 (176 residues), 38.9 bits, see alignment E=1.4e-13 PF00534: Glycos_transf_1" amino acids 202 to 352 (151 residues), 76.9 bits, see alignment E=2.1e-25 PF13692: Glyco_trans_1_4" amino acids 204 to 333 (130 residues), 64.5 bits, see alignment E=2e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3230)

MetaCyc: 62% identical to GDP-Man:alpha-D-Gal-diphosphoundecaprenol alpha-1,3-mannosyltransferase (Salmonella enterica enterica serovar Newport)
RXN-21846 [EC: 2.4.1.379]

Predicted SEED Role

"Glycosyltransferase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.379

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRG0 at UniProt or InterPro

Protein Sequence (409 amino acids)

>Psyr_3230 Glycosyl transferase, group 1 (Pseudomonas syringae pv. syringae B728a)
MRIAIVHDWLVSYAGAERVLASLINVWPAADLFAVIDFLSDQDRAHLHGKVARTTFIQKL
PGARKHYSRYLPLMPLAIEQLDLSGYDLIISSSHAVAKGVLCGPDQLHISYVHSPIRYAW
DLQHQYLQESGLNKGAKGGLARLILHYMRLWDQRTSTGVDAFIANSGFIGARITKAYRRD
STVIYPPVDTLGFTAQGARGDFYLCASRMVPYKRMPMIVEAFAAMPDKRLIMIGDGPDLA
KAQAIASQVSNVTLLGFQPGSVLLEHMRSARAFVFAAEEDFGISPVEAQACGTPVIAFAK
GGVMETVRGLDHPQPTGVFYREQTVASLIAAIGEFEAAQSRISPEACRANAERFSVARFE
QEIKAFVEDRLALSHGVHLARPPQSQRVAQASPGLGSELPNRVVPLKIV