Protein Info for Psyr_3224 in Pseudomonas syringae pv. syringae B728a

Annotation: Low molecular weight phosphotyrosine protein phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF01451: LMWPc" amino acids 5 to 141 (137 residues), 126.3 bits, see alignment E=5.9e-41

Best Hits

Swiss-Prot: 44% identical to ETP_ECO57: Low molecular weight protein-tyrosine-phosphatase Etp (etp) from Escherichia coli O157:H7

KEGG orthology group: K01104, protein-tyrosine phosphatase [EC: 3.1.3.48] (inferred from 100% identity to psb:Psyr_3224)

MetaCyc: 44% identical to phosphotyrosine-protein phosphatase Etp (Escherichia coli K-12 substr. MG1655)
Protein-tyrosine-phosphatase. [EC: 3.1.3.48]

Predicted SEED Role

"Low molecular weight protein-tyrosine-phosphatase Wzb (EC 3.1.3.48)" in subsystem Colanic acid biosynthesis (EC 3.1.3.48)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRG6 at UniProt or InterPro

Protein Sequence (150 amino acids)

>Psyr_3224 Low molecular weight phosphotyrosine protein phosphatase (Pseudomonas syringae pv. syringae B728a)
MFSSVLVVCVGNVCRSPMAVAMLHQRLKATQVRIQSAGIAALSGSSIDPTAHAVLQSHRV
QPQRHAARQMSRELLRQADLILLMEQAHFSDVLDLAPEVRGKAFLIGKWQDPLDITDPYR
RPASAFEQTYAQLSRCIDDWLPHFQSGATG