Protein Info for Psyr_3211 in Pseudomonas syringae pv. syringae B728a

Annotation: ATP-binding region, ATPase-like:Histidine kinase, HAMP region

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 151 to 170 (20 residues), see Phobius details PF26769: HAMP_PhoQ" amino acids 179 to 223 (45 residues), 51.4 bits, see alignment 8.3e-18 PF02518: HATPase_c" amino acids 332 to 436 (105 residues), 69.6 bits, see alignment E=3e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3211)

Predicted SEED Role

"Sensor protein PhoQ (EC 2.7.13.3)" in subsystem Lipid A modifications (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRH9 at UniProt or InterPro

Protein Sequence (439 amino acids)

>Psyr_3211 ATP-binding region, ATPase-like:Histidine kinase, HAMP region (Pseudomonas syringae pv. syringae B728a)
MKSIQRRLSLGLIAVMVVVGLVMAQTSLWLFEVGLQRYLESGLRNESENLLVALVRGPAG
LQLDDHRLSGAYQRPLSGHYFRMDLPQGHWRSRSLWDFELPQPGVGLHANLELGKTGQSL
LMLTSEYRKFGKQVSITVAQDYTPVRASFRLMQQIGLGLGLAALILVLVLQRITVRRALR
PLETVREQIFQLQQGQRSQLDNQVPLELEPLVAQINHLLAHTEDSLKRSRNALGNLGHAL
KTPLAVLLSLALSGQLDANPALRRTLQEQLENIRLRLERELNRARLSGDALPGARFDCDA
ELPGLFSTLGMIHGAHLQLVNDVEAGMYLPWDREDILELLGNLLDNACKWADSEVRLNIL
SQAQGFCLLVDDDGPGIPEAQRAEVFSRGARLDEQITGHGLGLGIVRDIVEAWGGQLQLQ
ESPAGGLRVRIDLPERTAP