Protein Info for Psyr_3192 in Pseudomonas syringae pv. syringae B728a

Annotation: Adenylosuccinate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00928: adenylosuccinate lyase
  • amino acids 28 to 471 (444 residues), 442.6 bits, E=7.1e-137
• PF00206: Lyase_1
  • amino acids 30 to 329 (300 residues), 215.7 bits, E=1.1e-67
• PF08328: ASL_C
  • amino acids 348 to 462 (115 residues), 174.4 bits, E=7.8e-56

Best Hits

Swiss-Prot: 88% identical to PUR8_PSEAE: Adenylosuccinate lyase (purB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01756, adenylosuccinate lyase [EC: 4.3.2.2] (inferred from 100% identity to psb:Psyr_3192)

MetaCyc: 71% identical to adenylosuccinate lyase (Escherichia coli K-12 substr. MG1655)
Adenylosuccinate lyase. [EC: 4.3.2.2]; 4.3.2.2 [EC: 4.3.2.2]

Predicted SEED Role

"Adenylosuccinate lyase (EC 4.3.2.2)" in subsystem De Novo Purine Biosynthesis or Purine conversions (EC 4.3.2.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of purine nucleotide salvage (12/14 steps found)
• inosine-5'-phosphate biosynthesis I (6/6 steps found)
• inosine-5'-phosphate biosynthesis II (5/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• adenosine ribonucleotides de novo biosynthesis (3/3 steps found)
• inosine-5'-phosphate biosynthesis III (5/6 steps found)
• dZTP biosynthesis (3/5 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Biosynthesis of alkaloids derived from histidine and purine
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.2.2

Sequence Analysis Tools

See Q4ZRJ8 at UniProt or InterPro

Protein Sequence (472 amino acids)

>Psyr_3192 Adenylosuccinate lyase (Pseudomonas syringae pv. syringae B728a)
MYDMRPFRRPTVREHPMQLSSLTAVSPVDGRYAGKTQALRPIFSEYGLIRFRVMVEVRWL
QRLAAHPQITEVPAFSAQANAILDALAEDFSVEHAERVKEIERTTNHDVKAVEYLLKEQA
AKLPELEKVSEFIHFACTSEDINNLSHALMLREGRDTVVLPLMRQIADAIRELAIRFADV
PMLSRTHGQPASPTTLGKELANVVYRLERQISQIAAVPLLGKINGAVGNYNAHLSAYPDI
DWEANARAFIEDELGLGFNPYTTQIEPHDYIAELFDAIARFNTILIDFDRDIWGYISLGY
FKQRTIAGEIGSSTMPHKVNPIDFENSEGNLGIANALFQHLASKLPVSRWQRDLTDSTVL
RNLGVGFAHSVIAYEASLKGISKLELNEQRIAADLDACWEVLAEPIQTVMRRYNIENPYE
KLKELTRGKGIGPEALQTFIDGLDMPSEAKAELKKLTPANYIGNAAAQAKRI