Protein Info for Psyr_3177 in Pseudomonas syringae pv. syringae B728a

Annotation: Recombination protein MgsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 PF05496: RuvB_N" amino acids 17 to 142 (126 residues), 52.8 bits, see alignment E=1.2e-17 PF07728: AAA_5" amino acids 50 to 140 (91 residues), 27.4 bits, see alignment E=9.1e-10 PF00004: AAA" amino acids 50 to 158 (109 residues), 62.7 bits, see alignment E=1.5e-20 PF16193: AAA_assoc_2" amino acids 184 to 260 (77 residues), 76.4 bits, see alignment E=5.1e-25 PF12002: MgsA_C" amino acids 261 to 427 (167 residues), 228.8 bits, see alignment E=1.1e-71

Best Hits

Swiss-Prot: 59% identical to RARA_HAEIN: Replication-associated recombination protein A (rarA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K07478, putative ATPase (inferred from 100% identity to psb:Psyr_3177)

Predicted SEED Role

"FIG065221: Holliday junction DNA helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRL3 at UniProt or InterPro

Protein Sequence (440 amino acids)

>Psyr_3177 Recombination protein MgsA (Pseudomonas syringae pv. syringae B728a)
MDLFSREPIAQPLAARLRATNLDEYVGQEHVLAHGKPLREALEQGALHSMIFWGPPGVGK
TTLAKLLAKVSDAHFETVSAVLAGVKEIRQAVEVARQQAGQYGKRTILFVDEVHRFNKSQ
QDAFLPYVEDGTLIFIGATTENPSFELNNALLSRARVYVLKSLDEAALRKLVNRALTEER
GLGKRQLTLSDEGFAILMSAADGDGRRMLNLLENASDLAEDGSEIDVGLLQSLLGDSRRR
FDKGGEAFYDQISALHKSIRGSNPDAALYWFARMIDGGCDPLYLARRVVRMASEDIGNAD
PRALPLCMSAWDVQERLGSPEGELAVAQAIVYLACAPKSNAVYMAFKAAMREAGEHGSLE
VPLHLRNAPTKLMKQLGYGEEYRYAHDEPDAYAAGEDYFPDELEPRQYYQPVPRGLELKI
GEKLRHLNALDDASPRKRRK