Protein Info for Psyr_3176 in Pseudomonas syringae pv. syringae B728a

Annotation: camphor resistance protein CrcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 56 (24 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details PF02537: CRCB" amino acids 6 to 119 (114 residues), 92.7 bits, see alignment E=8.4e-31

Best Hits

Swiss-Prot: 100% identical to CRCB_PSEU2: Putative fluoride ion transporter CrcB (crcB) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K06199, CrcB protein (inferred from 100% identity to psb:Psyr_3176)

Predicted SEED Role

"CrcB protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRL4 at UniProt or InterPro

Protein Sequence (124 amino acids)

>Psyr_3176 camphor resistance protein CrcB (Pseudomonas syringae pv. syringae B728a)
MIQTILAVSIAGIAGTLLRFATGTWVSANWPRYFYAATLAVNIVGCLIIGVLYGLFLLRP
EVPIEIRAGLIVGFVGGLTTFSSFSLDTLRLLESGQVPLALGYAGISVFGGLLATWAGLS
LTRL