Protein Info for Psyr_3169 in Pseudomonas syringae pv. syringae B728a

Annotation: DsrE-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 120 transmembrane" amino acids 23 to 41 (19 residues), see Phobius details PF02635: DsrE" amino acids 4 to 119 (116 residues), 70.5 bits, see alignment E=7.6e-24 TIGR03010: sulfur relay protein TusC/DsrF" amino acids 5 to 119 (115 residues), 129.5 bits, see alignment E=2.9e-42

Best Hits

Swiss-Prot: 64% identical to TUSC_PSEAE: Protein TusC homolog (tusC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K07236, tRNA 2-thiouridine synthesizing protein C (inferred from 100% identity to psb:Psyr_3169)

Predicted SEED Role

"tRNA 5-methylaminomethyl-2-thiouridine synthase TusC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRM1 at UniProt or InterPro

Protein Sequence (120 amino acids)

>Psyr_3169 DsrE-like protein (Pseudomonas syringae pv. syringae B728a)
MPRSLLVVTRQSPWSGPGAREALDIVLAGGAFDLSVGLLFLDDGVFQLSPQQSPDALQQK
DLTANLKALPMFGVEDLYVCGQSLAERGISLGALSEEMSQLTTRAELSALFDRYDEVITI