Protein Info for Psyr_3161 in Pseudomonas syringae pv. syringae B728a

Annotation: Type I secretion system ATPase, PrtD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 598 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 253 to 282 (30 residues), see Phobius details TIGR01842: type I secretion system ATPase" amino acids 16 to 558 (543 residues), 784.1 bits, see alignment E=3.4e-240 PF00664: ABC_membrane" amino acids 26 to 283 (258 residues), 45.3 bits, see alignment E=9.4e-16 PF00005: ABC_tran" amino acids 350 to 495 (146 residues), 105.3 bits, see alignment E=4.2e-34

Best Hits

Swiss-Prot: 59% identical to APRD_PSEAE: Alkaline protease secretion ATP-binding protein AprD (aprD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K12536, ATP-binding cassette, subfamily C, bacterial HasD (inferred from 100% identity to psb:Psyr_3161)

Predicted SEED Role

"ABC-type protease exporter, ATP-binding component PrtD/AprD" in subsystem Protein secretion by ABC-type exporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRM9 at UniProt or InterPro

Protein Sequence (598 amino acids)

>Psyr_3161 Type I secretion system ATPase, PrtD (Pseudomonas syringae pv. syringae B728a)
MSALPQSARPPLYKALADYKSALIGVGCFTALINVLMLAPSIYMLQVYDRVLTSQNQTTL
AMLTLMVVGFFAFIGLLEMVRSFVVIRIGSELEKRFNLRVYQAAFESNLHAGQRQAGQAL
GDLTFIRQFLTGPALFAFFDAPWFPIYLAVIFLFDPWLGVLASVGTVLLVGLACLNEWLT
RKPLAEASGYSQQSAQLATRHLQQAEAIQAMGMLEVLRRRWFHVHGRFLALQNRASDTGA
VISSISKALRLCLQSLVLGLGALLVINGDMTAGMMIAGSILMGRVLSPIDQLIAVWKQWS
SARLAYGRLDQLLKTYAEPAPRMPLPAPRGQISAEQVSAAPPGKTSPTIQQVSFQLQAGE
VLGVLGASGSGKSTLARVLVGVWPALGGTVRLDGADMHRWDREALGPYIGYLPQDIELFG
GSVAENIARFREGDASAVVAAAQLAGVHELILRLPQGYDTRLGDDGAGLSGGQKQRVALA
RALYGDPRLVVLDEPNSNLDAAGEAALTQAIAELKTRGCTVVLVTHRTQSLNQTDRLLVL
SEGRMQAFGATAQVLQALSGQPSSTQAPQAQPQSQSRPAPAGLSMSRQYGTQNRQSDV