Protein Info for Psyr_3160 in Pseudomonas syringae pv. syringae B728a

Annotation: Type I secretion membrane fusion protein, HlyD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 21 to 445 (425 residues), 372.7 bits, see alignment E=1.3e-115 PF00529: CusB_dom_1" amino acids 33 to 398 (366 residues), 54.8 bits, see alignment E=1.8e-18 PF13533: Biotin_lipoyl_2" amino acids 65 to 107 (43 residues), 31.2 bits, see alignment 3.7e-11 PF13437: HlyD_3" amino acids 297 to 395 (99 residues), 49.6 bits, see alignment E=1.5e-16

Best Hits

Swiss-Prot: 44% identical to PRTE_DICCH: Proteases secretion protein PrtE (prtE) from Dickeya chrysanthemi

KEGG orthology group: K12537, protease secretion protein HasE (inferred from 100% identity to psb:Psyr_3160)

Predicted SEED Role

"ABC-type protease exporter, membrane fusion protein (MFP) family component PrtE/AprE" in subsystem Protein secretion by ABC-type exporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRN0 at UniProt or InterPro

Protein Sequence (445 amino acids)

>Psyr_3160 Type I secretion membrane fusion protein, HlyD (Pseudomonas syringae pv. syringae B728a)
MNSPIDTHYAVPGKERGVQFFVRAGWILMLAGAGSFFLWASLAPLDQGIAVQGTVVVSGK
RKAVQSLDGGVVSKILVSEGQLVKEGEPLFRLDQTQVEADVQSLRAQYRMAWASLARWQS
ERDNLDEVRFPAELIAAGQGQDPDPRLALVLEGQRQLFSSRRQALAREQSGLQASIEGAG
LQLAGMRRARSDLLAQADSLRKQLSNLEPLAQNGFIPGNRLLEFQRQLSQVQQSLAQNAG
ETGRIEQGIVESRLRLQQQREEYQKEVRSQWADAQVKALTLEQQLASAGFSLQHSAILAP
ADGIAVNLGVHTEGAVVRAGETLLEIVPQGTRLEVEGRLPVQLIDKVASHLPVDILFTAF
NQSRTPRVSGEVSLISADQMQDEKTGQPYYVLRTSVGDAALEKLNGLVIKPGMPAEMFVR
TGERSLLNYLFKPLLDRAGSALTEE