Protein Info for Psyr_3150 in Pseudomonas syringae pv. syringae B728a

Annotation: type II secretion system protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 166 to 189 (24 residues), see Phobius details amino acids 220 to 238 (19 residues), see Phobius details amino acids 368 to 393 (26 residues), see Phobius details TIGR02120: type II secretion system protein F" amino acids 4 to 400 (397 residues), 491.7 bits, see alignment E=1e-151 PF00482: T2SSF" amino acids 67 to 190 (124 residues), 114.4 bits, see alignment E=1.7e-37 amino acids 271 to 392 (122 residues), 90.5 bits, see alignment E=4.3e-30

Best Hits

KEGG orthology group: K02455, general secretion pathway protein F (inferred from 100% identity to psb:Psyr_3150)

Predicted SEED Role

"General secretion pathway protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRP0 at UniProt or InterPro

Protein Sequence (400 amino acids)

>Psyr_3150 type II secretion system protein (Pseudomonas syringae pv. syringae B728a)
MSLFKYRALDAQGAPQNGTLEARDQDAAIAALQKRGLMVLQVDAAGLGGLRRALGSGLLN
GAALVSFTQQLATLLGAGQPLERSLGILLKQPGQPQTKALIERIREQVKAGKPLSVALEE
EGSQFSPLYISMVRAGEAGGALESTLRQLSDYLERSQLLRGEVINALIYPAFLVVGVLGS
LALLLAYVVPQFVPIFKDLGVPIPLITEVILNLGEFLSDYGLAVLAGLIALIWGMAIRMR
DPQRRERRDRRLLGIRVIGPLLQRIEAARLTRTLGTLLTNGVALLQALVIARQVCTNRAL
QAQVEQAAESVKGGGTLASAFGAQPLLPDLALQMIEVGEQAGELDTMLMKVADVFDVEAK
RGIDRMLAALVPALTVVMAGMVAVIMLAIMLPLMSLTSNI