Protein Info for Psyr_3141 in Pseudomonas syringae pv. syringae B728a

Annotation: type II and III secretion system protein:NolW-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 776 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details TIGR02517: type II secretion system protein D" amino acids 108 to 755 (648 residues), 463.4 bits, see alignment E=5.9e-143 PF21305: type_II_gspD_N0" amino acids 109 to 174 (66 residues), 33.8 bits, see alignment E=3.6e-12 PF03958: Secretin_N" amino acids 205 to 263 (59 residues), 38.9 bits, see alignment 1.2e-13 amino acids 270 to 335 (66 residues), 34.2 bits, see alignment E=3.5e-12 amino acids 345 to 505 (161 residues), 41 bits, see alignment E=2.6e-14 PF00263: Secretin" amino acids 580 to 745 (166 residues), 181 bits, see alignment E=2.3e-57

Best Hits

KEGG orthology group: K02453, general secretion pathway protein D (inferred from 96% identity to psb:Psyr_3141)

Predicted SEED Role

"General secretion pathway protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRP9 at UniProt or InterPro

Protein Sequence (776 amino acids)

>Psyr_3141 type II and III secretion system protein:NolW-like protein (Pseudomonas syringae pv. syringae B728a)
MGTFSGVPAIATLRTPLLCLATAVALGGCASQSDTLDPDNGMLQEALQGTGSQRPPVDPR
SERPPVEPPSQQTTSSPQRQIIKGNQRFIRQPAAAPAARQAETGDIVFNFTNQPIQAVIN
SIMGDLLHENYSIAQGVKGDVSFSTSKPVNKQQALSILETLLSWTDNAMIKQGNRYVILP
SNQAVAGKLVPEMRVAQPSAGMSARLFPLRYISATEMQKLLKPFARENAFLLVDPARNVL
SLAGTPEELANYQDTIDTFDVDWLKGMSVGVFGLQRASVGELMPELQKMFGPESGMPLAG
MVRFLPIERTNSVVAISSQPEYLHEVGEWIHTIDEGGGNEPQMYVYDVRNMKATDLAKYL
RQIYGTGAIKDDSPAKVAPGLRTTTLSSLNSSGGSGVGGMSSSNGLGSNGGGMGNGGGFG
NSQSMNNSQNSADSESEGDDQGGGDSDSDSASQDGSGSSGASKSLDASTRITAQKSSNQL
LVRTRPAQWKEIESAIKRLDNPPLQVQIETRILEVKLTGELDMGVQWYLGRLAGNSGTTG
NVTNTAGSQGAIGTGGAALASTDAFFYSFVSNNLQVALRALETNGRTQVLSAPSLVVMNN
QQAQIQVGDNIPISQTSINTNTNTGTTLSSVEYVQTGVILDVVPRINPGGLVYMDIQQQV
SDADSSGTTDANGNPRISTRSVATQVAAQSGQTVLLGGLIKQDNAETVNAVPYLGRIPGL
RWLFGNTSKSKDRTELIVLITPRVITSSSQARQVTDDYRQQMQLLKPEVSRTSMQN