Protein Info for Psyr_3130 in Pseudomonas syringae pv. syringae B728a

Annotation: Secretion protein HlyD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 27 to 46 (20 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 59 to 376 (318 residues), 203.3 bits, see alignment E=2.4e-64 PF25973: BSH_CzcB" amino acids 88 to 222 (135 residues), 31.6 bits, see alignment E=2.4e-11 PF25917: BSH_RND" amino acids 88 to 219 (132 residues), 27.5 bits, see alignment E=4.7e-10 PF25954: Beta-barrel_RND_2" amino acids 232 to 303 (72 residues), 31.3 bits, see alignment E=3.9e-11 PF25967: RND-MFP_C" amino acids 310 to 366 (57 residues), 28.6 bits, see alignment E=2.2e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3130)

Predicted SEED Role

"Membrane-fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRR0 at UniProt or InterPro

Protein Sequence (395 amino acids)

>Psyr_3130 Secretion protein HlyD (Pseudomonas syringae pv. syringae B728a)
MTFSFATLLRSCCRVSGNIRPLHSLYAQPHVVLGFISLLSLSACSAGKPAEKALVRVSAQ
PVALLNVASSVTLTGDIQARKVTEQSFRVSGKLIKRYVDVGDRVRVGQVLARLDAREQNT
ELASARTEVAVRQSRLHLAEQNYQRQQVLLPKGFTNLSEYQKARSGLDSARGDLAALQAQ
QANARDQVGYTGLFAAADGIVTARYAEEGQVVQAATAIFSVAHDGEREAVFSAYESLLRA
DQKGAAVTVSPLGQPGTQLTGIIREITPIVSAANGTLRVRVALQGAAASLALGSVVSARL
QTQSQSAFALPWSALSRTQGQPAVWRVDAQARVRLTPVKVLRYEQGQVIVSEGLSEGDRV
VSRGLQFLYPGQRVEVAGQAQAEQSVSLASSGAAQ