Protein Info for Psyr_3122 in Pseudomonas syringae pv. syringae B728a

Annotation: D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 PF00389: 2-Hacid_dh" amino acids 28 to 313 (286 residues), 40.2 bits, see alignment E=4e-14 PF02826: 2-Hacid_dh_C" amino acids 115 to 287 (173 residues), 195.6 bits, see alignment E=7.3e-62 PF03446: NAD_binding_2" amino acids 149 to 255 (107 residues), 22.3 bits, see alignment E=1.7e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3122)

Predicted SEED Role

"D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95)" in subsystem Glycine and Serine Utilization or Pyridoxin (Vitamin B6) Biosynthesis or Serine Biosynthesis (EC 1.1.1.95)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.95

Use Curated BLAST to search for 1.1.1.95

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRR8 at UniProt or InterPro

Protein Sequence (318 amino acids)

>Psyr_3122 D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding protein (Pseudomonas syringae pv. syringae B728a)
MTPLKIAVLDDWQNVASTVVDWSVLGSMGEISFLHDYPADTSTMARRLRDFDIICVMRER
TLFDATLLSQLPALKLLVTGGMRNAAIDTAAAKRQGIVVCGTESYKHAAPELTWALIMGI
TRNLVAEANALRAGNWQVGLGSDLHGKTLGILGLGSIGKWIARYGQAFGMKVIAWSQNLT
PEAAAESGVTYVSKQQLFEQADVLSVHLVLSDRSRGLVDAEALNWMKPGAYLINSSRGPI
IDQAALIETLQQRRISGAALDVFDIEPLPADHPFRTLDNVLATPHIGYVTENNYRTFYGQ
MIEDIQAWHAGSPIRVFD