Protein Info for Psyr_3105 in Pseudomonas syringae pv. syringae B728a

Annotation: phosphate ABC transporter membrane protein 1, PhoT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 39 to 63 (25 residues), see Phobius details amino acids 89 to 114 (26 residues), see Phobius details amino acids 126 to 150 (25 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 242 to 265 (24 residues), see Phobius details amino acids 299 to 321 (23 residues), see Phobius details TIGR02138: phosphate ABC transporter, permease protein PstC" amino acids 34 to 324 (291 residues), 308.1 bits, see alignment E=2.6e-96 PF00528: BPD_transp_1" amino acids 109 to 326 (218 residues), 56.4 bits, see alignment E=1.7e-19

Best Hits

Swiss-Prot: 65% identical to PSTC_XYLFA: Phosphate transport system permease protein PstC (pstC) from Xylella fastidiosa (strain 9a5c)

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 99% identity to pst:PSPTO_3268)

MetaCyc: 56% identical to phosphate ABC transporter membrane subunit PstC (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRT5 at UniProt or InterPro

Protein Sequence (331 amino acids)

>Psyr_3105 phosphate ABC transporter membrane protein 1, PhoT family (Pseudomonas syringae pv. syringae B728a)
MTENTQYLSANVSAGESEGEKRAKRDHRHDLWFKRSLQAAAMLVLALLGCIALSTLWGGS
LAFQTFGFGFLTSTEWDVNAGKFGALVPIYGTLVTSFLALLIAVPVSFGIAIFLTEVAPP
WLRMPIASAIELLAGIPSIIYGMWGLFVFGPFMAEHLSPWITENLGALPLIGPMFQGPPL
GIGMLTAGIVLAIMITPFITSVMQEVFRTVPVALKESAYALGGTTWEVVWDIVLPYTRSA
VVGGVFLGLGRALGETMAVTFVLGNAHQFSASLMMPSSSIASVIANEFNEAYTDLHRSAL
IALGFLLFVVTFIVLALARLMLSRLSRKEGL