Protein Info for Psyr_3104 in Pseudomonas syringae pv. syringae B728a

Annotation: phosphate ABC transporter membrane protein 2, PhoT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 74 to 99 (26 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 265 to 288 (24 residues), see Phobius details TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 19 to 290 (272 residues), 275.8 bits, see alignment E=1.6e-86 PF00528: BPD_transp_1" amino acids 92 to 287 (196 residues), 71.4 bits, see alignment E=4.3e-24

Best Hits

Swiss-Prot: 58% identical to PSTA_XYLFA: Phosphate transport system permease protein PstA (pstA) from Xylella fastidiosa (strain 9a5c)

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 100% identity to psb:Psyr_3104)

MetaCyc: 56% identical to phosphate ABC transporter membrane subunit PstA (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRT6 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Psyr_3104 phosphate ABC transporter membrane protein 2, PhoT family (Pseudomonas syringae pv. syringae B728a)
MSKDVTGSEHLYRVRSIKNKIAMVLSCGATAFGLLWLVWILLTTIIKGIDALNLQLFTGM
TPPPGTEGGLANAFYGSVLMSGIGLLIGTPIGLMAGIWLAEFARYTKLGNTVRFINDILL
SAPSIVLGLFVYTVVVLPLNAVTGHQVGFSAIAGALALALLVIPVVVRTTDEMMQLQPST
MREAALALGVPQWKLTLQIVLRAAKAGVVTGVLLALARITGETAPLLFTAFGNQFWSSDL
LKPIASVPVVVFQYAMSPFDDWHSLAWAGALVMTLFVLILSLLSRLILLRNRAS