Protein Info for Psyr_3100 in Pseudomonas syringae pv. syringae B728a

Annotation: nitrite reductase [NAD(P)H], small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13806: Rieske_2
  • amino acids 20 to 126 (107 residues), 122.7 bits, E=3.1e-40
• TIGR02378: nitrite reductase [NAD(P)H], small subunit
  • amino acids 21 to 127 (107 residues), 94.4 bits, E=2.1e-31

Best Hits

KEGG orthology group: K00363, nitrite reductase (NAD(P)H) small subunit [EC: 1.7.1.4] (inferred from 100% identity to psb:Psyr_3100)

Predicted SEED Role

"Nitrite reductase [NAD(P)H] small subunit (EC 1.7.1.4)" in subsystem Nitrate and nitrite ammonification (EC 1.7.1.4)

MetaCyc Pathways

• alkylnitronates degradation (2/2 steps found)
• nitrate reduction V (assimilatory) (1/2 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.7.1.4

Use Curated BLAST to search for 1.7.1.4

Sequence Analysis Tools

See Q4ZRU0 at UniProt or InterPro

Protein Sequence (128 amino acids)

>Psyr_3100 nitrite reductase [NAD(P)H], small subunit (Pseudomonas syringae pv. syringae B728a)
MNASQTIRTGDNAPTAAQQHWQTLCGRADLVANSGVVAWLDGAQVALFYLPETAQGEQLF
AIDNRDPKSGANVIGRGLIGQIAGELVIASPLYKQHFRLHDGSCIEYPEQRLDVWPVRLK
GDQVEIAV