Protein Info for Psyr_3096 in Pseudomonas syringae pv. syringae B728a

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 PF00005: ABC_tran" amino acids 28 to 177 (150 residues), 129.5 bits, see alignment E=1.4e-41

Best Hits

Swiss-Prot: 42% identical to FECE_ECOLI: Fe(3+) dicitrate transport ATP-binding protein FecE (fecE) from Escherichia coli (strain K12)

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 100% identity to psb:Psyr_3096)

MetaCyc: 42% identical to ferric citrate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-9-RXN [EC: 7.2.2.18]

Predicted SEED Role

"Cobalt ABC transporter, ATP-binding component CbtL"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.34

Use Curated BLAST to search for 3.6.3.34 or 7.2.2.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRU4 at UniProt or InterPro

Protein Sequence (263 amino acids)

>Psyr_3096 ABC transporter (Pseudomonas syringae pv. syringae B728a)
MNALPHSLNAPVLGCAGLGYSVRGAALLRDVDLSIAAGETLAVVGPNGSGKSTLLKLLAG
IQKPVSGSVSLDGQALEALSRRDVARLLAVVEQQAETSDAVTVLDAVELGRTPWLSALEP
WSATDDAIVRQALQDVDMLHLQKRAWHTLSGGERQRVHIARALAQRPQILLLDEPTNHLD
IQHQLTILGLVRALPVTTVIALHDLNQALDCDRVAVMEKGRLVALGAPLEVLTPERLLST
FGVVAHWLTDPSDGAKILRLRSR