Protein Info for Psyr_3095 in Pseudomonas syringae pv. syringae B728a

Annotation: transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 66 to 85 (20 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 245 to 272 (28 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details PF01032: FecCD" amino acids 17 to 335 (319 residues), 296 bits, see alignment E=3e-92 PF00950: ABC-3" amino acids 114 to 309 (196 residues), 33.7 bits, see alignment E=2.9e-12

Best Hits

Swiss-Prot: 35% identical to BTUC_SALPA: Vitamin B12 import system permease protein BtuC (btuC) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to psb:Psyr_3095)

Predicted SEED Role

"Cobalt ABC transporter, permease component CbtK"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRU5 at UniProt or InterPro

Protein Sequence (340 amino acids)

>Psyr_3095 transport system permease protein (Pseudomonas syringae pv. syringae B728a)
MRLPIALSHVLWVSAVLVLAIMIGAAIGETSISLQVVFQVLANKLWAASYVLDPIDEGIV
WNYRLTRAIVAAACGAGLAICGVVLQSLLRNPLADPYLLGISAGASTGAVLVAILGFGAG
AISMSAGAFVGAVAAFSLVALLAHSSRGTTAAGQIILAGIAGSQLFNALTSFLITKSASS
EQARGIMFWLLGNLSGVRWHSVWLAVPTVLVGLLVCLWHRRALDAFTFGSDSAASLGIAV
RRVQIILITTAALVTAVMVSIVGSIGFVGLVIPHAVRMLVGVRHARLVPLSALSGALFLI
AADILSRTLIKGQALPIGVITALIGAPVFALILTRGNSTR