Protein Info for Psyr_3078 in Pseudomonas syringae pv. syringae B728a

Annotation: Peptidase M20:Peptidase M20

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF04389: Peptidase_M28" amino acids 96 to 208 (113 residues), 30.7 bits, see alignment E=5.1e-11 PF01546: Peptidase_M20" amino acids 109 to 407 (299 residues), 101.3 bits, see alignment E=1.4e-32 PF07687: M20_dimer" amino acids 213 to 312 (100 residues), 78.9 bits, see alignment E=5.4e-26

Best Hits

KEGG orthology group: K01295, glutamate carboxypeptidase [EC: 3.4.17.11] (inferred from 100% identity to psb:Psyr_3078)

Predicted SEED Role

"Glutamate carboxypeptidase (EC 3.4.17.11)" (EC 3.4.17.11)

Isozymes

Compare fitness of predicted isozymes for: 3.4.17.11

Use Curated BLAST to search for 3.4.17.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRW0 at UniProt or InterPro

Protein Sequence (413 amino acids)

>Psyr_3078 Peptidase M20:Peptidase M20 (Pseudomonas syringae pv. syringae B728a)
MRSFSRSPLAAHLALALALTALAPAAMAEPHKAIQADAEQYKDEALKLLERLVNIDSGSG
YVPGLTKVSDIAIEELKKLGATIELVPNTPEASNHVIATLKGTGKAKILLMAHMDTVFKE
GSAAERPFHIKDGRAYGPGVMDDKGGIVAAIYALKVLHNLKFTDYAQITVLLDASEETGS
GVATELIKKTAKEHDVTLNLEPGRPADGLVVWRKGSATALVEVKGKASHAGVAPELGRNA
ATEVAHQILQLGKLGDEEKKTTINFTVLKAGDRTNVIPDQASAKADVRAAVPEEFDRVEQ
DLARVSANRLVPDTEVKTSLVRGLPPMPQTAQSDALVAMAQGIYGELGRTLTIEGSGGAA
DSSLSASVGTPTLDGFGIVGGNIHTPEEYAEVGSVAPRIYLLSRMIMKLSGQQ