Protein Info for Psyr_3075 in Pseudomonas syringae pv. syringae B728a

Annotation: Type I secretion membrane fusion protein, HlyD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 transmembrane" amino acids 57 to 78 (22 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 54 to 473 (420 residues), 412.3 bits, see alignment E=1.2e-127 PF25917: BSH_RND" amino acids 105 to 354 (250 residues), 29.5 bits, see alignment E=1.3e-10 PF25988: HH_CyaD" amino acids 126 to 322 (197 residues), 160.5 bits, see alignment E=9.8e-51 PF25994: HH_AprE" amino acids 130 to 318 (189 residues), 55.6 bits, see alignment E=2e-18 PF26002: Beta-barrel_AprE" amino acids 363 to 449 (87 residues), 71 bits, see alignment E=1.9e-23

Best Hits

KEGG orthology group: K11003, hemolysin D (inferred from 100% identity to psb:Psyr_3075)

Predicted SEED Role

"HlyD family secretion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRW3 at UniProt or InterPro

Protein Sequence (473 amino acids)

>Psyr_3075 Type I secretion membrane fusion protein, HlyD (Pseudomonas syringae pv. syringae B728a)
MSNAESTGLLQRYRRVWRQSWRHRREMDAPKRLAHEVQFLPAALELQDKPSHPAPRVFMW
AIMFFAALALLWACLGKIDVVATASGKIIPSGKTKTIQSSETAVVKAIHVRDGQSVKAGQ
LLLELDSTSADADVGRVRSDLLAARIDSARAAAMLDAINQRKPPRDLTGTILDADPMHVL
AAERWLQGQYQEYRSSLDLVDAEIQQRQADIQAARIQVMSLQKTLPIATKLASDYENLLK
KQYIARHAYLEKEQARLDLERQLSVQQASVLQSTAARQEAERRREGVVAQTRRAMLDLLQ
QADQKIASFNQDLTKARYQEDLTTLEAPVDGTVQQLAVHTVGGVVTPAQPLMVLVPDGQP
VEVEAMLENKDVGFVRAGQAVTVKVETFTFTKYGTIEGEVISVSNDAIEDEKRGLIYSSK
IRLNSDTLNVNGVDIKLSPGMAVTAEVTTNKRRVIEYFLSPLQQHASESFRER