Protein Info for Psyr_3074 in Pseudomonas syringae pv. syringae B728a

Annotation: Hemolysin-type calcium-binding region:hemolysin-type calcium binding related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 855 PF00353: HemolysinCabind" amino acids 11 to 44 (34 residues), 37.2 bits, see alignment (E = 2.3e-13) amino acids 137 to 170 (34 residues), 30.8 bits, see alignment (E = 2.3e-11) amino acids 162 to 197 (36 residues), 41.3 bits, see alignment (E = 1.2e-14) amino acids 172 to 206 (35 residues), 38.8 bits, see alignment (E = 7.1e-14) amino acids 190 to 223 (34 residues), 34.4 bits, see alignment (E = 1.8e-12) amino acids 323 to 358 (36 residues), 31.7 bits, see alignment (E = 1.2e-11) amino acids 332 to 367 (36 residues), 31.8 bits, see alignment (E = 1.1e-11) amino acids 351 to 384 (34 residues), 30.3 bits, see alignment (E = 3.3e-11) amino acids 360 to 385 (26 residues), 22.1 bits, see alignment (E = 1.2e-08) amino acids 477 to 503 (27 residues), 10.7 bits, see alignment (E = 4.5e-05) amino acids 491 to 521 (31 residues), 36.5 bits, see alignment (E = 3.7e-13) amino acids 504 to 539 (36 residues), 49.8 bits, see alignment (E = 2.6e-17) amino acids 531 to 565 (35 residues), 37.7 bits, see alignment (E = 1.6e-13) amino acids 540 to 566 (27 residues), 25.2 bits, see alignment (E = 1.3e-09) amino acids 672 to 702 (31 residues), 26.6 bits, see alignment (E = 4.6e-10) amino acids 695 to 728 (34 residues), 40 bits, see alignment (E = 3.1e-14) PF06594: HCBP_related" amino acids 89 to 127 (39 residues), 46.7 bits, see alignment (E = 2.5e-16) amino acids 267 to 305 (39 residues), 42 bits, see alignment (E = 7.2e-15) amino acids 428 to 468 (41 residues), 56.7 bits, see alignment 1.9e-19 amino acids 609 to 648 (40 residues), 52.2 bits, see alignment 4.6e-18 amino acids 771 to 813 (43 residues), 24.1 bits, see alignment 2.9e-09

Best Hits

KEGG orthology group: None (inferred from 94% identity to psb:Psyr_3074)

Predicted SEED Role

"Alkaline phosphatase (EC 3.1.3.1)" in subsystem Phosphate metabolism (EC 3.1.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.1

Use Curated BLAST to search for 3.1.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRW4 at UniProt or InterPro

Protein Sequence (855 amino acids)

>Psyr_3074 Hemolysin-type calcium-binding region:hemolysin-type calcium binding related protein (Pseudomonas syringae pv. syringae B728a)
MGDTMATIINGQSGDDWLYGTSANDILDGGAGNDRLSGGLGNDTYLFYRGMGQDTVTDFD
WTVGNIDTIKVAADIAPADVTVSRDGTYLYLSIKGTTDKMSVTFFNNINYQVERVEFADG
TVWDIDTLKTMTRGVASDTADTLYGDVGDDVLDGLNGNDKLYGEEGNDLLSGGEGNDTLN
GGTGNDTLNGGAGNDSLSGDDGDDTLDGGAGNDYLSGSRGNDTYLFYRGMGQDTISEFDT
TAGNADTIKVAADIIPDDVVVRRENTDLYLSIKGTTDWMKIYSYTDSGYQVERVEFADGT
VWSVSDLKRLSRVVASEGAETIYGDETSEQLDGLGGNDQIYGLAGNDVLLGGAGDDLLDG
GMGLDTLDGGAGNDMLYGGSGNDTYLFQRGGGQDVINDRDWTAGNIDTLKLAPGIVSTDI
KVSRAGNNLELAIIGTSDKITVRDWFYSADSQVEQVQFADGTLWDVATLNAMVKGVATEG
NDVLQGEESVADTLNGLGGDDTLYGLSGNDTLNGGAGNDTLYGGAGADTLDGGAGNDTLY
GGAGADTLDGGVGNDNLYGDAGNDTYLFYRGAGQDWISDYDSSAGNLDVIRVSDSLTPAD
IQLSRSAYDLYVGIAGSADKLTVSGWFSNTSTQVEQIQFSDGTTWGIDAIRAMSSGTASQ
GNDVLYGNDALADSLSGLDGDDEINGLGGNDILSGGAGNDRLYGDAGNDTLTGGTGNDQL
DGGRGNDLYQFERGDGQDVINDFDPDANTDVLQFGAGIAADQLWFSKNGWDLEVGVIGTA
DKVTVSNWSFWGAGSWEKAQQIEQFRTDDGKVLLGGQVDQLVEAMAAFAPPAAGELKLSE
SYQASLNVVIASNWQ