Protein Info for Psyr_3072 in Pseudomonas syringae pv. syringae B728a

Annotation: HMG-CoA lyase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 PF00682: HMGL-like" amino acids 4 to 259 (256 residues), 112.3 bits, see alignment E=1.4e-36

Best Hits

KEGG orthology group: K01666, 4-hydroxy 2-oxovalerate aldolase [EC: 4.1.3.39] (inferred from 100% identity to psb:Psyr_3072)

Predicted SEED Role

"4-hydroxy-2-oxovalerate aldolase (EC 4.1.3.39)" (EC 4.1.3.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRW6 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Psyr_3072 HMG-CoA lyase-like protein (Pseudomonas syringae pv. syringae B728a)
MADVKILDVTLRDGGYRNNFNFTEDQAQVITTGLANAGVDLCEIGYCKGSFAPKGEHGLT
SDVGAVFIEKIAQAAKGRIELAVMVHPRNITTDDLAMLKEQGVSMIRVCLRRDQLDEGLV
TLSLARDHGFSVSANVTHVTSQTPGSVLDTAVRAEGAGADIVCCADSNGHMVPTDVDRLF
SRLSSRLLVPLGFHAHNNLSLALANAAAAIEAGAEYIDTSICGMGKGAGNLHLSMLVAYL
ERTGVSHGYDLVKVIELSEATARAIPQNNMPSPLMDIILGTYNFPYDSSQRMRDTLERFQ
LTSEYRAIEVMYQQDKVARLAPRAVLSTIATGLPNGAKGVAL