Protein Info for Psyr_3059 in Pseudomonas syringae pv. syringae B728a

Annotation: Hemolysin-type calcium-binding region:Peptidase M10A and M12B, matrixin and adamalysin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 535 PF00413: Peptidase_M10" amino acids 69 to 168 (100 residues), 33.2 bits, see alignment E=1.2e-11 PF16313: DUF4953" amino acids 152 to 192 (41 residues), 24.7 bits, see alignment 3.5e-09 PF08548: Peptidase_M10_C" amino acids 212 to 343 (132 residues), 42.6 bits, see alignment E=1.5e-14 amino acids 414 to 533 (120 residues), 27.3 bits, see alignment E=7.5e-10 PF00353: HemolysinCabind" amino acids 301 to 335 (35 residues), 25.2 bits, see alignment 3.3e-09 amino acids 397 to 430 (34 residues), 34.4 bits, see alignment (E = 4.2e-12) amino acids 405 to 439 (35 residues), 35 bits, see alignment 2.8e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3059)

Predicted SEED Role

"RTX toxins and related Ca2+-binding proteins"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRX9 at UniProt or InterPro

Protein Sequence (535 amino acids)

>Psyr_3059 Hemolysin-type calcium-binding region:Peptidase M10A and M12B, matrixin and adamalysin (Pseudomonas syringae pv. syringae B728a)
MPGPNESSPAELLPEGAPDDRVTSLLWGPFWLGDSSGTHLTYSFHKADSVYATDYSRSQE
PGDAYSLTDAQAAAAKSALDAWSAVADIKFTEVQDTPDNVGDIRFGGFKGLQGTEFGQAY
APGTLGRSGDVWIGPNVNAADPAKGTDDYLTFMHETGHALGLKHSFEASQYNDVLLDAKF
EDARYTIMSYTNNYSFKPTTPMLLDIAAMQFIYGANTHYHTGDDVYKWAPGQSVFETIWD
AGGKDTIDASNQEASVKINLNEGEFSTIGKAFLDYNANPDAPTSMNSGLAIAYGAHIENA
IGSAFNDTLIGNELDNVLNGRGGLDTMVGGLGNDTYVIDQAGELDLVQEKADQGIDTLKI
TYDNTSPIAQVINLNAGTLANFENVHLKGEGAFTVLGNDRNNTLTGNDADNVLFGGAGND
KLVGGQGADIMTGGSGADRFVFNNLSEMGKGHNSDVITDFNSQQGDKLSFLKMDANVDTK
ALDAFSFIGSGEFTGAGQLRFADHVLSGNVNGDLHADFEIQLVGVSEFHAHDLAV