Protein Info for Psyr_3044 in Pseudomonas syringae pv. syringae B728a

Annotation: Paraquat-inducible protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 transmembrane" amino acids 48 to 68 (21 residues), see Phobius details amino acids 95 to 120 (26 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details PF04403: PqiA" amino acids 45 to 199 (155 residues), 181.2 bits, see alignment E=6.4e-58

Best Hits

KEGG orthology group: K03808, paraquat-inducible protein A (inferred from 100% identity to psb:Psyr_3044)

Predicted SEED Role

"Paraquat-inducible protein A" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRZ4 at UniProt or InterPro

Protein Sequence (204 amino acids)

>Psyr_3044 Paraquat-inducible protein A (Pseudomonas syringae pv. syringae B728a)
MNGIPFAHEHKLCLCHTCGYACQEDATRCPRCDSPVHKRKPNSISRTWAYLIAALIFYIP
ANVLPVMYTNLLGNRSESTIMSGVIEFFESGSWDIAILIFVASVLVPCIKFLVLGMLLIT
CQRRSTWAMRERARLYRFIELIGYWSMLDVLVVALVASLVQFRELSTIEPRIGILFFGLV
VVMTMFAAMSFDPRLIWDAEVEDV