Protein Info for Psyr_3028 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function DUF28

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 PF20772: TACO1_YebC_N" amino acids 8 to 70 (63 residues), 82.1 bits, see alignment E=3.4e-27 PF01709: Transcrip_reg" amino acids 78 to 230 (153 residues), 148.6 bits, see alignment E=1.4e-47

Best Hits

Swiss-Prot: 100% identical to Y3028_PSEU2: Probable transcriptional regulatory protein Psyr_3028 (Psyr_3028) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3028)

Predicted SEED Role

"FIG033889: YebC paralog in Betaproteobacteria"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZS10 at UniProt or InterPro

Protein Sequence (234 amino acids)

>Psyr_3028 Protein of unknown function DUF28 (Pseudomonas syringae pv. syringae B728a)
MGAQWKVKHKEAAANAKGRTFGKLSKEIMIAARAGADPDMNSRLRLVVEQAKKASMPRET
LERAIKKGAGLLGESVNFERLTYEGFAPHRVPVIVECLTDNINRTVSEIRVLFRKGQLGA
AGSVSWDFLYQGMIEAVPAAADADPELAAIEAGAQDFEPGEEGATLFLTESTDMDAVCKA
LPEFGFTVQSAQLGYRPKSTVDGLTDEQMAEVEAFLEAIDNHDDVQNVYVGLAG