Protein Info for Psyr_3025 in Pseudomonas syringae pv. syringae B728a

Annotation: Major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 22 to 42 (21 residues), see Phobius details amino acids 51 to 76 (26 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details amino acids 283 to 303 (21 residues), see Phobius details amino acids 309 to 333 (25 residues), see Phobius details amino acids 345 to 367 (23 residues), see Phobius details amino acids 379 to 397 (19 residues), see Phobius details PF12832: MFS_1_like" amino acids 20 to 129 (110 residues), 26.6 bits, see alignment E=4.9e-10 PF07690: MFS_1" amino acids 26 to 358 (333 residues), 63 bits, see alignment E=3.6e-21 PF00083: Sugar_tr" amino acids 48 to 128 (81 residues), 28.6 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3025)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZS13 at UniProt or InterPro

Protein Sequence (409 amino acids)

>Psyr_3025 Major facilitator superfamily (Pseudomonas syringae pv. syringae B728a)
MSLSSNDSTSPDVKSDGRARNHLGFLAFTTLCFFAASSTPTPLYHLYQEAWGFSAGVLTL
IFAVYAFSLLAALLMGGSLSDYLGRRPVIFGALLLQSVSMLLFILASDVSWLVAARLLQG
FATGLAASALGAALLDSDSVKGPLINSISPMLGMAVGALGTALLAQFAPLPLMLGYCLLL
AAFLSQALYLGRVEETVSRQPGVWQSLKPSLHVPQQARRMLWLVLPVDIAAWALGGFFLS
LSPSLLVAATGSTSPLNGGLAVAALTLSGAAAILTLRQREPVLGLWVGASFLPLGVAVVL
LSINLGLLWLFFVGAVVAGVGFGSSFLGALRMLMPLAHAHERGGLMSAFLVLSYLAFCIP
ALVAGFFARSAGLVMTSNVYGAVVITLALIALASLIVRRAASANKNAHA