Protein Info for Psyr_3003 in Pseudomonas syringae pv. syringae B728a

Annotation: [Acyl-carrier protein] phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF02525: Flavodoxin_2" amino acids 1 to 196 (196 residues), 169.2 bits, see alignment E=9.2e-54 PF03358: FMN_red" amino acids 14 to 147 (134 residues), 38.2 bits, see alignment E=1.1e-13

Best Hits

Swiss-Prot: 100% identical to AZOR_PSEU2: FMN-dependent NADH-azoreductase (azoR) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K01118, FMN-dependent NADH-azoreductase [EC: 1.7.-.-] (inferred from 100% identity to psb:Psyr_3003)

Predicted SEED Role

"FMN-dependent NADH-azoreductase"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZS35 at UniProt or InterPro

Protein Sequence (202 amino acids)

>Psyr_3003 [Acyl-carrier protein] phosphodiesterase (Pseudomonas syringae pv. syringae B728a)
MNLLHLDSSILGDHSASRQLTHEVVQAYLTAHADSQVTYRDLASDALGHFSAASLAAAGT
PVEVRDAAQQQEVAGNEATLQQFLDSDVLVIGAPMYNFTIPTQLKAWFDRILIAGRTFRY
SEAGPEGLCGGKKVIIVSTSGGLHAGQPTGVGHEELLKALFAFIGITDLQFVRAHGLAYG
EEPRASAMSAAQHYIQNELFAA