Protein Info for Psyr_2987 in Pseudomonas syringae pv. syringae B728a

Annotation: Cof protein:HAD-superfamily hydrolase, subfamily IIB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 TIGR00099: Cof-like hydrolase" amino acids 9 to 262 (254 residues), 197.5 bits, see alignment E=3.1e-62 TIGR01484: HAD hydrolase, family IIB" amino acids 9 to 235 (227 residues), 96.9 bits, see alignment E=1.9e-31 PF08282: Hydrolase_3" amino acids 10 to 262 (253 residues), 227.4 bits, see alignment E=3.9e-71 PF05116: S6PP" amino acids 160 to 263 (104 residues), 37.2 bits, see alignment E=3.8e-13

Best Hits

KEGG orthology group: K07024, (no description) (inferred from 100% identity to psb:Psyr_2987)

Predicted SEED Role

"HMP-PP hydrolase (pyridoxal phosphatase) Cof, detected in genetic screen for thiamin metabolic genes (PMID:15292217)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZS51 at UniProt or InterPro

Protein Sequence (269 amino acids)

>Psyr_2987 Cof protein:HAD-superfamily hydrolase, subfamily IIB (Pseudomonas syringae pv. syringae B728a)
MSELPVQFLLSDIDGTLLRRDHSLSQANIDAVKRLRNAGVHFTLASSRPPRAMRQVIEAL
SVDLPTVAFNGGTITHPDGSLLVAHRIDPRAVRICLELFAGQNVAIWVFADDQWLLLDPH
ADYVDHELRALGYGYVQVESFEPYLDRVDKIVAASADFELLKTLEAQLNPQIEGLALAAR
SQKYYLDVTALEANKGSALVALADYLGVDLSRTAAIGDGGNDVAMFHKAGLSIAMGQGEQ
TVKGQADHVTDSNEQDGVANAIERYILSA