Protein Info for Psyr_2986 in Pseudomonas syringae pv. syringae B728a

Annotation: Glycoside hydrolase, family 15

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 605 PF19291: TREH_N" amino acids 2 to 152 (151 residues), 86.1 bits, see alignment E=2.2e-28 PF00723: Glyco_hydro_15" amino acids 220 to 584 (365 residues), 270.8 bits, see alignment E=2.1e-84

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2986)

Predicted SEED Role

"glycosyl hydrolase, family 15"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZS52 at UniProt or InterPro

Protein Sequence (605 amino acids)

>Psyr_2986 Glycoside hydrolase, family 15 (Pseudomonas syringae pv. syringae B728a)
MAALIEDYALLGNCETAALVARDGSLDWLCFPRFDSTACFAALLGGDEHGRWKIAPTAEV
IAVERRYRDGTLILETVFETRDGRAMLIDFMPMKTSGHVVRMVVGLSGRVEFAVDLAIRF
DYGSSVPWVERKDAHTLTAVAGPEMLVLRSPVALHPQDHHTASRFHVDEGERKVFTLAYQ
ASFAPLLDQIDADQALETTAAYWREFSDRCPDVGPWTAQVKRSLITLKAMTYAPTGGIVA
AVTTSLPEQLGGERNWDYRYCWLRDATMTLLAFMNLGYFEEAQAWRDWLLRSVAGNPEQI
QIMYGVGGERRLQEYELPWLSGYEHSLPVRVGNGAATQVQLDVYGEVADAMIQALRGGMA
QHPRSVAISKVVMPYLEKIWHLPDAGIWEIRSEPRHFTHSKVMAWVAFDRNATQIAQAAE
SDEDRALATHYRKVADEIHADVCRHGFDAELGSFVQTYGSTEVDASLLQIVLTGFLAPED
PRVIGTVAQIERTLMQDGLLLRYDNERSVDGVAGREGTFLVCSFWLADAYVLLGRADDAA
QLFERLCGLCNDVGLLAEQYDPKGGRMLGNFPQAFSHIGIINTALNLHRAVCPALARTSG
VLEEA