Protein Info for Psyr_2979 in Pseudomonas syringae pv. syringae B728a

Annotation: NADPH-glutathione reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 PF07992: Pyr_redox_2" amino acids 5 to 317 (313 residues), 234.3 bits, see alignment E=5.2e-73 PF13738: Pyr_redox_3" amino acids 121 to 293 (173 residues), 56.9 bits, see alignment E=5.1e-19 PF00070: Pyr_redox" amino acids 168 to 239 (72 residues), 68.3 bits, see alignment E=1.7e-22 PF02852: Pyr_redox_dim" amino acids 338 to 446 (109 residues), 127 bits, see alignment E=9.5e-41

Best Hits

Swiss-Prot: 80% identical to GSHR_PSEAE: Glutathione reductase (gor) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00383, glutathione reductase (NADPH) [EC: 1.8.1.7] (inferred from 100% identity to psb:Psyr_2979)

MetaCyc: 42% identical to glutathione reductase (NADPH) (Escherichia coli K-12 substr. MG1655)
Glutathione-disulfide reductase. [EC: 1.8.1.7]

Predicted SEED Role

"Glutathione reductase (EC 1.8.1.7)" in subsystem Glutathione: Redox cycle (EC 1.8.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZS59 at UniProt or InterPro

Protein Sequence (452 amino acids)

>Psyr_2979 NADPH-glutathione reductase (Pseudomonas syringae pv. syringae B728a)
MAFDFDLFVIGAGSGGVRAARFAAGFGARVAVAESRYLGGTCVNVGCVPKKLLVYGAHFS
EDFDHAKGFGWSLGEAEFDWATLIANKDREINRLNGIYRKLLVDSGVTLLEGHARLTGPQ
QVEINGQTYSAERILVATGGWPQVPDVPGREHAITSNEAFYLKTLPKRVVVVGGGYIAVE
FASIFNGLGADTTLVYRRELFLRGFDGGVRTHLHEELLKRDMTIRFNSDIERIDKQADGS
LLLSMKGGGTLETDCVFYATGRRPMLDNLGLDSVDVKLDEHGYIKVDEHYQSSEPSILAI
GDVIGGVQLTPVALAEGMAVARRLFKPEQYRPVDYNHIPTAVFSLPNIGTVGLTEEDAIK
AGHDVQIFESRFRPMKLTLTDDQERTLMKLVVDAKTDRVLGCHMVGPDAGEIVQSLAIAI
KAGATKQVFDDTIGVHPTAAEEFVTMRTPVKR