Protein Info for Psyr_2974 in Pseudomonas syringae pv. syringae B728a

Annotation: FAD-dependent pyridine nucleotide-disulfide oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 TIGR03140: alkyl hydroperoxide reductase subunit F" amino acids 1 to 515 (515 residues), 792.8 bits, see alignment E=6.5e-243 PF13192: Thioredoxin_3" amino acids 124 to 194 (71 residues), 37.4 bits, see alignment E=7.2e-13 PF07992: Pyr_redox_2" amino acids 212 to 502 (291 residues), 174.6 bits, see alignment E=1.1e-54 PF12831: FAD_oxidored" amino acids 213 to 240 (28 residues), 27.7 bits, see alignment (E = 6.1e-10) PF01134: GIDA" amino acids 213 to 241 (29 residues), 20.5 bits, see alignment (E = 7.8e-08) PF13738: Pyr_redox_3" amino acids 257 to 485 (229 residues), 67 bits, see alignment E=6.1e-22 PF00070: Pyr_redox" amino acids 355 to 428 (74 residues), 48.3 bits, see alignment E=4.3e-16

Best Hits

Swiss-Prot: 82% identical to AHPF_PSEPK: Alkyl hydroperoxide reductase subunit F (ahpF) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03387, alkyl hydroperoxide reductase subunit F [EC: 1.6.4.-] (inferred from 100% identity to psb:Psyr_2974)

MetaCyc: 64% identical to alkyl hydroperoxide reductase, AhpF component (Escherichia coli K-12 substr. MG1655)
RXN-8506 [EC: 1.5.1.37]; R4-RXN [EC: 1.5.1.37, 1.11.1.26]

Predicted SEED Role

"Alkyl hydroperoxide reductase protein F (EC 1.6.4.-)" in subsystem Thioredoxin-disulfide reductase (EC 1.6.4.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.4.-

Use Curated BLAST to search for 1.11.1.26 or 1.5.1.37 or 1.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZS64 at UniProt or InterPro

Protein Sequence (520 amino acids)

>Psyr_2974 FAD-dependent pyridine nucleotide-disulfide oxidoreductase (Pseudomonas syringae pv. syringae B728a)
MLDANLKAQLKSYLERVTRPIEIVASLDDGAKSQEMLALLNDVISVSKDVTLNDSGTDAR
TPSFSLSSPGHDISLRFAGIPMGHEFTSLVLALLQVGGYPPKVSAETIEQVRALEGEFHF
ETYFSQSCQNCPDVVQALNLMAVLNPGIKHVAIDGALFQDEVTDRKIMSVPSIYLNGELF
GQGRMGLEEILAKIDTGAGARQAEKLNAKQAFDVLVVGGGPAGSAAAVYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQHTEGPKLAVALEEHVKQYEVDIMNLQRADKLIPGAAGEL
HEVKFASGASLKAKTLILATGARWREMNVPGEQQYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVSHVTLLEFDVQLRADAVLQRKLHSLPNVTVITSAQTTEVTGDEQ
KVNGLRYKNRTTGEEITVPLEGIFVQIGLLPNSEWLKGAIELSPRGEIVVDSRGETSVPG
IFAAGDVTVAPYKQIIIALGEGAKASLSAFDHLIRTSAPA