Protein Info for Psyr_2965 in Pseudomonas syringae pv. syringae B728a

Annotation: amino acid ABC transporter ATP-binding protein, PAAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF00005: ABC_tran" amino acids 33 to 187 (155 residues), 127.3 bits, see alignment E=6.5e-41

Best Hits

Swiss-Prot: 46% identical to AOTP_PSEAE: Arginine/ornithine transport ATP-binding protein AotP (aotP) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02028, polar amino acid transport system ATP-binding protein [EC: 3.6.3.21] (inferred from 100% identity to psb:Psyr_2965)

Predicted SEED Role

"ABC-type polar amino acid transport system, ATPase component"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.21

Use Curated BLAST to search for 3.6.3.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZS73 at UniProt or InterPro

Protein Sequence (265 amino acids)

>Psyr_2965 amino acid ABC transporter ATP-binding protein, PAAT family (Pseudomonas syringae pv. syringae B728a)
MSDLAHTAIPPVTTAQIQLKHVVKDFGHNRIIDHLDLSIPQGQKVALIGPSGSGKSTVLR
LIKGLENYQQGSIEVAGRAVPARTSGWRWPGARKAPVEHRVGMVFQQFNLFPHLTVQENV
TEAPLRVLRLPREEALERAHQYLGLVGLAHKADAYPSQLSGGQQQRVAIARALAMRPQVM
LFDEVTSALDPELVGEVLAVIRSIAHEFQMTMLLVTHEMKFAQDIADRVLFMEGGRIVAD
GTPSEILLNPQNERTRRFLQRVEQR